labscoop
  • Product
    MarketplaceEverything your lab needs in one place.
    Shared CartStreamlined requisitioning.
    CuratorCurated supplies from product experts.
    Science SamplesDiscover better, cost effective supplies.
  • Enterprise
    SolutionsSupercharge your organization’s eProcurement.
    IntergationsIntegrate your existing ERP & eProcurement.
    OnboardingDrive end user option with ease.
  • Pricing
  • Company
    AboutThe company, our mission and our values.
    Supplier PartnersOur niche and industry leading suppliers.
    CareersJoin us. Be yourself. Drive our mission.
    BlogCompany blog.
    NewsroomGet the latest news and updates.
    Press KitAccess brand assets.
  • Support
Sign in
Create an Account
  • Product
    MarketplaceShared CartScienceSamplesCurator
  • Enterprise
    SolutionsIntegrationsOnboarding
  • Company
    AboutBlogSupplier PartnersCareersNewsroomPress Kit
  • Support
    Help CenterFAQsSchedule a DemoReport a BugMake a Suggestion
logosupport@labscoop.com800 316 3081
Terms of UseTerms & Conditions of SalePrivacy Policy
© Labscoop LLC. All rights reserved

EN
usaUSA
© Labscoop LLCTerms of UseTerms & Conditions of SalePrivacy Policy
EN
usaUSA
ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 650)
SKU / CAT#: 253684-ML650-100ul
$83100
usd
$831.00
  1. Home
  2. Life Science
  3. Antibodies
  4. ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 650)
253684-ML650-100ul

ZNF207 (Zinc Finger Protein 207, DKFZp761N202) (MaxLight 650)

United States Biological Corp
Write a review
0
0citationscitations
0
0questionsquestions
0
SKU / CAT#: 253684-ML650-100ul
MPN: 253684-ML650-100ul
$83100
usd
$831.00
Available
SHIPS Oct 31st
Available
SHIPS Oct 31st
SKU
Unit size / Options
Availability
Price
No products found
Description
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Mouse monoclonal antibody raised against a partial recombinant ZNF207. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ Storage...
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Mouse monoclonal antibody raised against a partial recombinant ZNF207. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ Storage...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
4°C Do Not Freeze
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Specifications
CLASS
Monoclonal Antibodies
SUBCLASS
Transcription Factors, Zinc (Ring) Finger
APPLICATION
FLISA IF WB
CLONE NUMBER
8G7
ACCESSION#
NP_003448
*USAGE / SAFETY STATEMENT
For laboratory research and development purposes only.
PURITY
Purified
PHYSICAL FORM
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
GRADE
Purified
ANTIBODY TYPE
Mab
ISOTYPE
IgG2a,k
IMMUNOGEN
ZNF207 (NP_003448, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
SPECIFIC ACTIVITY
Recognizes ZNF207.
COMMODITY CODE
30021010
HOST
mouse
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
4°C Do Not Freeze
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
Join BETA

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Categories
Related Blog Articles