GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (AP)

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDT KPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFN DKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE Storage...