CCR9 (C-C Chemokine Receptor Type 9, CC-CKR-9, C-C CKR-9, CCR-9, CDw199, GPR28, GPR-9-6, G-protein Coupled Receptor 28) (PE)

CKR9/CCR9 (C-C chemokine receptor type 9), also designated GPR-9-6, is a G protein-coupled, seven-transmembrane domain receptor protein. It has been found that CKR9/CCR9 is a receptor for the thymus expressed chemokine TECK. CKR9/CCR9 and TECK are thought to play a specialized role in the immune response because both are highly expressed by T lymphocytes in the small intestine, where they are not in other tissues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL Storage...