CCL18 (C-C Motif Chemokine 18, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-regulated Chemokine, Small-inducible Cytokine A18, AMAC1, DCCK1, MIP4, PARC, SCYA18) (PE)

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA* Storage...