CCL13 (C-C Motif Chemokine 13, CK-beta-10, Monocyte Chemoattractant Protein 4, Monocyte Chemotactic Protein 4, MCP-4, NCC-1, Small-inducible Cytokine A13, MCP4, NCC1, SCYA13, MGC17134) (Biotin)

CCL13 is a small cytokine belonging to the CC chemokine family that is also known as thymus and activation regulated chemokine (TARC). This protein induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils by binding cell surface G-protein linked chemokine receptors such as CCR2, CCR3 and CCR5. It can be induced by the inflammatory cytokines interleukin-1 and TNF-a. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT Storage...