Cpn10 Protein

Blue Ice or 4ºC. All orders received in North America by 12:00 PM PST Monday to Thursday will usually be shipped out on the same day. North American customers will typically receive their orders within 1-2 business days. All shipments are F.O.B. from point of shipment, pre-paid and added to the invoice. Freight charges include but not limited to: priority service and packaging materials.Products are shipped with “cold packs” in insulated containers. There is a charge for this packaging and for the shipping costs via FedEx. Please inspect packages immediately upon receipt and inform Labscoop Customer Support of any shortage or damage within 48 hours of receipt. We can only accept returns after we have given prior authorization and issued specific shipping instructions. If a customer wishes to use their own FedEx account number please indicate this on the purchase order or during checkout.

Canada

WB, SDS-PAGE

https://www.ncbi.nlm.nih.gov/gene/3336

NM_002157.2

Non-hazardous

Non-hazardous

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

>90%

Lot/batch specific. See included datasheet.

Human

No tag

Multi-Step Purified

ISO 9001:2015

Cpn10

20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Mitochondrion Matrix

Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).

1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549. 2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460. 3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560. 4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.

Cancer | Heat Shock

10kDa Chaperonin Protein, Chaperonin 10 Protein, Cpn 10 Protein, EPF Protein, GROES Protein, Heat Shock 10kD protein1 Protein, HSP10 Protein, HSPE1 Protein