AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney...
AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Aquaporin 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Aquaporin 2 antibody is available for research use only.
This Aquaporin 2 antibody is available for research use only.
FORMAT
Antigen affinity purified
APPLICATION.1
WB, IHC-P, FACS
HOST SPECIES
Rabbit
ISOTYPE
Rabbit IgG
REACTIVITY SPECIES
Human, Mouse, Rat
CLONALITY
Polyclonal (rabbit origin)
PURIFICATION
Antigen affinity
IMMUNOGEN
Amino acids EPDTDWEEREVRRRQSVELHSPQSLPRGTKA of human Aquaporin 2 were used as the immunogen for the Aquaporin 2 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
APPLICATION NOTES
Optimal dilution of the Aquaporin 2 antibody should be determined by the researcher.
Questions & Answers (0)
Citations (0)
+2
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Aquaporin 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Aquaporin 2 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.