Anti-Myelin Basic Protein Antibody [7D2]

Primary

Monoclonal

Storing antibodies at various temperatures (up to 40°C) for one week does not affect their activity. As a precautionary measure, we ship all products in insulated packaging with cold packs to provide extra temperature stability in transit. The cold packs may be thawed when you receive the shipment, please be assured that this is normal and your product(s) are safe to use. Once you have received your product(s), please follow the storage instructions on the datasheet(s).

WB, ICC/IF, IHC

7D2

Myelin Basic Protein

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Liquid

1 mg/ml

18.5 kDa and 21.5 kDa (human isotypes)

Mouse

IgG1

Human, Horse, Cow, Porcine, Rat, Mouse

Monoclonal

Unconjugated

Immunogen affinity purification.

WB: 1:5,000-1:10,000, ICC/IF: 1:2,000-1:5,000, IHC: 1:2,000-1:5,000

Native Myelin Basic Protein isolated and purified from bovine brain.

This antibody only binds the 21.5 kDa and 18.5 kDa rat MBP isotypes but binds all four isotypes of human MBP and bovine MBP. The epitope is mapped to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5 kDa sequence. This antibody can be used to identify oligodendrocytes and Schwann cells in neural cell culture, to visualize myelin sheaths and myelinating cells in sectioned material, and to probe western blots for MBP gene products.

Supplied in Phosphate Buffered Saline with 50% Glycerol and 5mM Sodium Azide.