Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Kaneka Eurogentec S.A.
SKU / CAT#: AS-24177
$28700
usd
$287.00
AS-24177

Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

AnaSpec Inc.
$28700
usd
$287.00
BadgeBadgeBadge
BadgeBadgeBadge
Available
SHIPS Jul 27th
Available
SHIPS Jul 27th
SKU
Unit size / Options
Availability
Price
No products found
Description
This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβγ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown...
This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβγ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown...
Shipping & Handling
Shipped In
Ambient
Safety & Storage
Storage Temperature
- 20°C
Safety Statement
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
Regulatory & Compliance
Badge
Specifications
CLASS
Peptides
COUNTRY OF ORIGIN
United States
*USAGE / SAFETY STATEMENT
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
PURITY
Peak Area by HPLC ≥95%
SOURCE
mouse, rat
MOLECULAR FORMULA
C217H340N46O63
DISCLAIMER
Labscoop LLC (the Seller), AnaSpec Inc. (the Manufacturer), and affiliates shall not be held liable for any damage resulting from handling or from contact with this product. The Seller and Manufacturer’s liability shall be limited strictly to the replacement of the non-compliant Products or Services or to the reimbursement of their price, at Seller’s sole election. The Seller and Manufacturer shall assume no other liability. Accordingly, taking account of the specific nature of the Products and Services and the multiple possible applications, the Seller and Manufacturer do not guarantee in particular that the Products and Services are adapted for the intended application, and it shall be the customer's responsibility to verify and to make sure that the Products and Services are appropriate and adequate for the intended application. Except as noted above, to the full extent permissible under the applicable legislation the Seller and Manufacturer may not be held liable for any cost or liability arising from or in connection with Products or Services, including damages or accidents to persons, damages to goods other than the Products or Services sold, loss of earnings or profits, harm to reputation, or any other prejudice arising directly or indirectly from the Products or Services, and including defective Products or Services. IN NO EVENT SHALL THE SELLER OR MANUFACTURER BE LIABLE UNDER THIS AGREEMENT FOR ANY PUNITIVE, EXEMPLARY, INDIRECT OR CONSEQUENTIAL DAMAGES, INCLUDING LOST PROFITS. The Products ordered by the Customer are exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. They shall not be used by the Customer for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices. Without prejudice to the other provisions of this Agreement that limit or exclude the Seller and Manufacturer’s liability, no liability will be accepted if the Customer who ordered Products intended exclusively for laboratory research uses said Products for purposes other than for research.
PHYSICAL FORM
Lyophilized
QUALITY CERTIFICATION / COMPLIANCE
Our 44,000 ft2 facility in California’s Silicon Valley, AnaSpec is a leading provider of R&D, GLP, and GMP grade proteomic products and services. Our quality is guaranteed not only through the commitment of our experienced and knowledgeable staff, but also through our highly-efficient and state-of-the-art facilities. ISO 7 Certified Cleanroom. Our state-of-the-art highly controlled GMP cleanroom area for downstream processing meets 10,000 (ISO 7) standards. Complete segregation between the upstream process (synthesis and cleavage) and the downstream processes (purification, lyophilization and packaging) mitigates the risk of cross-contamination. We have multiple cleanrooms to perform GMP peptide and dye manufacturing. AnaSpec’s GMP manufacturing is overseen by our independent QA department, that ensures GMP operations adhere to our robust Quality Management System (QMS). AnaSpec’s QA department monitors GMP manufacturing as per parts of 21 CFR 210, 211 applicable for products intended use and per part 820 of 21 CFR for Diagnostic applications. Compliant with 21 CFR parts 210, 211 & 820 & ISO13485 applicable for Product intended use
SUBCLASS
Other CPP Peptides
FORMULA WEIGHT
4601.7
CONJUGATION/TAG
Unconjugated
SEQUENCE
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
3-LETTER SEQUENCE
H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Val-Thr-Asp-Gln-Leu-Gly-Glu-Asp-Phe-Phe-Ala-Val-Asp-Leu-Glu-Ala-Phe-Leu-Gln-Glu-Phe-Gly-Leu-Leu-Pro-Glu-Lys-Glu-OH
BIOMARKER TARGET
Anti-BetaGamma
Questions & Answers (0)
Citations (0)
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Shipping & Handling
Shipped In
Ambient
Safety & Storage
Storage Temperature
- 20°C
Safety Statement
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Blog Articles