labscoop
  • Product
    MarketplaceEverything your lab needs in one place.
    Shared CartStreamlined requisitioning.
    CuratorCurated supplies from product experts.
    Science SamplesDiscover better, cost effective supplies.
  • Enterprise
    SolutionsSupercharge your organization’s eProcurement.
    IntergationsIntegrate your existing ERP & eProcurement.
    OnboardingDrive end user option with ease.
  • Pricing
  • Company
    AboutThe company, our mission and our values.
    Supplier PartnersOur niche and industry leading suppliers.
    CareersJoin us. Be yourself. Drive our mission.
    BlogCompany blog.
    NewsroomGet the latest news and updates.
    Press KitAccess brand assets.
  • Support
Sign in
Create an Account
  • Product
    MarketplaceShared CartScienceSamplesCurator
  • Enterprise
    SolutionsIntegrationsOnboarding
  • Company
    AboutBlogSupplier PartnersCareersNewsroomPress Kit
  • Support
    Help CenterFAQsSchedule a DemoReport a BugMake a Suggestion
logosupport@labscoop.com800 316 3081
Terms of UseTerms & Conditions of SalePrivacy Policy
© Labscoop LLC. All rights reserved

EN
usaUSA
© Labscoop LLCTerms of UseTerms & Conditions of SalePrivacy Policy
EN
usaUSA
B-type Natriuretic Peptide, BNP-32, human
Kaneka Eurogentec S.A.
SKU / CAT#: AS-24015
$28700
usd
$287.00
  1. Home
  2. Life Science
  3. Proteins & Peptides
  4. B-type Natriuretic Peptide, BNP-32, human
AS-24015

B-type Natriuretic Peptide, BNP-32, human

AnaSpec Inc.
Write a review
0
0citationscitations
0
0questionsquestions
0
SKU / CAT#: AS-24015
MPN: AS-24015
$28700
usd
$287.00
BadgeBadgeBadge
BadgeBadgeBadge
Available
SHIPS Oct 27th
Available
SHIPS Oct 27th
SKU
Unit size / Options
Availability
Price
No products found
Description
B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S). This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations. BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is...
B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S). This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations. BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is...
Shipping & Handling
Shipped In
Ambient
Safety & Storage
Storage Temperature
- 20°C
Safety Statement
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
Regulatory & Compliance
Badge
Technical Documents
Datasheet (2)
AS-24015 B type Natriuretic Peptide BNP 32 human (EN)
AS-24016 B type Natriuretic Peptide BNP 32 human (EN)
MSDS (2)
AS-24015 Natriuretic Peptides (EN)
AS-24016 Natriuretic Peptides (EN)
Specifications
3-LETTER SEQUENCE
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)
BIOMARKER TARGET
Natriuretic Peptide
CLASS
Peptides
SUBCLASS
Vasoconstriction/Vasodilation
COUNTRY OF ORIGIN
United States
CAS#
114471-18-0
*USAGE / SAFETY STATEMENT
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
DISCLAIMER
Labscoop LLC (the Seller), AnaSpec Inc. (the Manufacturer), and affiliates shall not be held liable for any damage resulting from handling or from contact with this product. The Seller and Manufacturer’s liability shall be limited strictly to the replacement of the non-compliant Products or Services or to the reimbursement of their price, at Seller’s sole election. The Seller and Manufacturer shall assume no other liability. Accordingly, taking account of the specific nature of the Products and Services and the multiple possible applications, the Seller and Manufacturer do not guarantee in particular that the Products and Services are adapted for the intended application, and it shall be the customer's responsibility to verify and to make sure that the Products and Services are appropriate and adequate for the intended application. Except as noted above, to the full extent permissible under the applicable legislation the Seller and Manufacturer may not be held liable for any cost or liability arising from or in connection with Products or Services, including damages or accidents to persons, damages to goods other than the Products or Services sold, loss of earnings or profits, harm to reputation, or any other prejudice arising directly or indirectly from the Products or Services, and including defective Products or Services. IN NO EVENT SHALL THE SELLER OR MANUFACTURER BE LIABLE UNDER THIS AGREEMENT FOR ANY PUNITIVE, EXEMPLARY, INDIRECT OR CONSEQUENTIAL DAMAGES, INCLUDING LOST PROFITS. The Products ordered by the Customer are exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. They shall not be used by the Customer for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices. Without prejudice to the other provisions of this Agreement that limit or exclude the Seller and Manufacturer’s liability, no liability will be accepted if the Customer who ordered Products intended exclusively for laboratory research uses said Products for purposes other than for research.
PURITY
Peak Area by HPLC ≥95%
PHYSICAL FORM
Lyophilized
FORMULA WEIGHT
3464.2
SOURCE
human
CONJUGATION/TAG
Unconjugated
QUALITY CERTIFICATION / COMPLIANCE
Our 44,000 ft2 facility in California’s Silicon Valley, AnaSpec is a leading provider of R&D, GLP, and GMP grade proteomic products and services. Our quality is guaranteed not only through the commitment of our experienced and knowledgeable staff, but also through our highly-efficient and state-of-the-art facilities. ISO 7 Certified Cleanroom. Our state-of-the-art highly controlled GMP cleanroom area for downstream processing meets 10,000 (ISO 7) standards. Complete segregation between the upstream process (synthesis and cleavage) and the downstream processes (purification, lyophilization and packaging) mitigates the risk of cross-contamination. We have multiple cleanrooms to perform GMP peptide and dye manufacturing. AnaSpec’s GMP manufacturing is overseen by our independent QA department, that ensures GMP operations adhere to our robust Quality Management System (QMS). AnaSpec’s QA department monitors GMP manufacturing as per parts of 21 CFR 210, 211 applicable for products intended use and per part 820 of 21 CFR for Diagnostic applications. Compliant with 21 CFR parts 210, 211 & 820 & ISO13485 applicable for Product intended use
MOLECULAR FORMULA
C143H244N50O42S4
SEQUENCE
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Questions & Answers (0)
Citations (0)
B-type Natriuretic Peptide, BNP-32, human
B-type Natriuretic Peptide, BNP-32, human
Shipping & Handling
Shipped In
Ambient
Safety & Storage
Storage Temperature
- 20°C
Safety Statement
Research Use Only (RUO) - This product is exclusively intended for laboratory research purposes and shall correspond to the quality and safety standards in accordance with said research purposes. The products shall not be used by the end user for any other purposes such as (the list is not exhaustive) diagnostic, prophylactic, therapeutic, cosmetic, commercial ends, or as food, ingredients or medical devices.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
Join BETA

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Categories
Related Blog Articles