labscoop
  • Product
    MarketplaceEverything your lab needs in one place.
    Shared CartStreamlined requisitioning.
    CuratorCurated supplies from product experts.
    Science SamplesDiscover better, cost effective supplies.
  • Enterprise
    SolutionsSupercharge your organization’s eProcurement.
    IntergationsIntegrate your existing ERP & eProcurement.
    OnboardingDrive end user option with ease.
  • Pricing
  • Company
    AboutThe company, our mission and our values.
    Supplier PartnersOur niche and industry leading suppliers.
    CareersJoin us. Be yourself. Drive our mission.
    BlogCompany blog.
    NewsroomGet the latest news and updates.
    Press KitAccess brand assets.
  • Support
Sign in
Create an Account
  • Product
    MarketplaceShared CartScienceSamplesCurator
  • Enterprise
    SolutionsIntegrationsOnboarding
  • Company
    AboutBlogSupplier PartnersCareersNewsroomPress Kit
  • Support
    Help CenterFAQsSchedule a DemoReport a BugMake a Suggestion
logosupport@labscoop.com800 316 3081
Terms of UseTerms & Conditions of SalePrivacy Policy
© Labscoop LLC. All rights reserved

EN
usaUSA
© Labscoop LLCTerms of UseTerms & Conditions of SalePrivacy Policy
EN
usaUSA
CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) (AP)
SKU / CAT#: C8297-98W-AP-100ul
$83100
usd
$831.00
  1. Home
  2. Life Science
  3. Antibodies
  4. CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) (AP)
C8297-98W-AP-100ul

CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced by gamma Interferon, MIG, Small-inducible Cytokine B9, SCYB9) (AP)

United States Biological Corp
Write a review
0
0citationscitations
0
0questionsquestions
0
SKU / CAT#: C8297-98W-AP-100ul
MPN: C8297-98W-AP-100ul
$83100
usd
$831.00
Available
SHIPS Oct 30th
Available
SHIPS Oct 30th
SKU
Unit size / Options
Availability
Price
No products found
Description
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Storage...
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Storage...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
4°C Do Not Freeze
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Specifications
CLASS
Monoclonal Antibodies
SUBCLASS
Growth Factors, Cytokines
APPLICATION
E
CLONE NUMBER
1F5
ACCESSION#
AAH63122
*USAGE / SAFETY STATEMENT
For laboratory research and development purposes only.
PURITY
Purified
PHYSICAL FORM
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).
GRADE
Purified
ANTIBODY TYPE
Mab
HOST SPECIES
human
ISOTYPE
IgG2a,k
CROSS REACTIVITY
Hu
IMMUNOGEN
Full-length recombinant protein corresponding to aa23-125 of human CXCL9 with GST tag. MW of the GST tag alone is 26kD.
SPECIFIC ACTIVITY
Recognizes human CXCL9.
COMMODITY CODE
30021010
HOST
mouse
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
4°C Do Not Freeze
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
Join BETA

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Categories
Related Blog Articles