Tetratricopeptide Repeat Protein 3 (TPR Repeat Protein 3, TTC3, E3 Ubiquitin-protein Ligase TTC3, DCRR1, Protein DCRR1, RING Finger Protein 105, RNF105, TPR Repeat Protein D, TPRD, TPRDIII) (FITC)

Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay...