TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ23157, DJ738A13.1) (FITC)

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN Storage...