UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (HRP)

Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide...