UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (HRP)
SKU / CAT#: 129647-HRP-100ul
$83100
usd
$831.00
129647-HRP-100ul

UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (HRP)

United States Biological Corp
SKU / CAT#: 129647-HRP-100ul
MPN: 129647-HRP-100ul
$83100
usd
$831.00
Available
SHIPS Oct 27th
Available
SHIPS Oct 27th
SKU
Unit size / Options
Availability
Price
No products found
Description
Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide...
Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
-20°C
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Specifications
CLASS
Monoclonal Antibodies
SUBCLASS
Ubiquitin
APPLICATION
E
CLONE NUMBER
2F7
ACCESSION#
BC040290, AAH40290
*USAGE / SAFETY STATEMENT
For laboratory research and development purposes only.
PURITY
Purified by Protein A affinity chromatography.
PHYSICAL FORM
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
GRADE
Affinity Purified
ANTIBODY TYPE
Mab
HOST SPECIES
human
ISOTYPE
IgG2a,k
CROSS REACTIVITY
Hu
IMMUNOGEN
Partial recombinant protein corresponding to aa1-76 from human MGC42638 (AAH40290) with GST tag. MW of the GST tag alone is 26kD.
SPECIFIC ACTIVITY
Recognizes human MGC42638.
COMMODITY CODE
30021010
HOST
mouse
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
-20°C
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Blog Articles