labscoop
  • Product
    MarketplaceEverything your lab needs in one place.
    Shared CartStreamlined requisitioning.
    CuratorCurated supplies from product experts.
    Science SamplesDiscover better, cost effective supplies.
  • Enterprise
    SolutionsSupercharge your organization’s eProcurement.
    IntergationsIntegrate your existing ERP & eProcurement.
    OnboardingDrive end user option with ease.
  • Pricing
  • Company
    AboutThe company, our mission and our values.
    Supplier PartnersOur niche and industry leading suppliers.
    CareersJoin us. Be yourself. Drive our mission.
    BlogCompany blog.
    NewsroomGet the latest news and updates.
    Press KitAccess brand assets.
  • Support
Sign in
Create an Account
  • Product
    MarketplaceShared CartScienceSamplesCurator
  • Enterprise
    SolutionsIntegrationsOnboarding
  • Company
    AboutBlogSupplier PartnersCareersNewsroomPress Kit
  • Support
    Help CenterFAQsSchedule a DemoReport a BugMake a Suggestion
logosupport@labscoop.com800 316 3081
Terms of UseTerms & Conditions of SalePrivacy Policy
© Labscoop LLC. All rights reserved

EN
usaUSA
© Labscoop LLCTerms of UseTerms & Conditions of SalePrivacy Policy
EN
usaUSA
KEL (Kell Blood Group Glycoprotein, CD238) (FITC)
SKU / CAT#: 128771-FITC-100ul
$83100
usd
$831.00
  1. Home
  2. Life Science
  3. Antibodies
  4. KEL (Kell Blood Group Glycoprotein, CD238) (FITC)
128771-FITC-100ul

KEL (Kell Blood Group Glycoprotein, CD238) (FITC)

United States Biological Corp
Write a review
0
0citationscitations
0
0questionsquestions
0
SKU / CAT#: 128771-FITC-100ul
MPN: 128771-FITC-100ul
$83100
usd
$831.00
Available
SHIPS Oct 29th
Available
SHIPS Oct 29th
SKU
Unit size / Options
Availability
Price
No products found
Description
Zinc endopeptidase with endothelin-3-converting enzyme activity. Cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNPSSRCQLW Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C...
Zinc endopeptidase with endothelin-3-converting enzyme activity. Cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNPSSRCQLW Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
-20°C
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Specifications
CLASS
Monoclonal Antibodies
SUBCLASS
CD Markers
APPLICATION
E
CLONE NUMBER
4B10
ACCESSION#
NM_000420, NP_000411.1
*USAGE / SAFETY STATEMENT
For laboratory research and development purposes only.
PURITY
Purified by Protein A affinity chromatography.
PHYSICAL FORM
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
GRADE
Affinity Purified
ANTIBODY TYPE
Mab
HOST SPECIES
human
ISOTYPE
IgG2a,k
CROSS REACTIVITY
Hu
IMMUNOGEN
Partial recombinant corresponding to aa633-732 from human KEL (NP_000411.1) with GST tag. MW of the GST tag alone is 26kD.
SPECIFIC ACTIVITY
Recognizes human KEL.
COMMODITY CODE
30021010
HOST
mouse
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
-20°C
Safety Statement
For laboratory research and development purposes only.
Regulatory & Compliance
Badge
Science SamplesWe’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
Join BETA

Join Our List

mail
Subscribe to the Scoop blog and get the latest updates on life in the lab.
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.
Related Blog Articles
Related Categories
Related Blog Articles