CCL24 (C-C Motif Chemokine 24, CK-beta-6, Eosinophil Chemotactic Protein 2, Eotaxin-2, Myeloid Progenitor Inhibitory Factor 2, MPIF-2, Small-inducible Cytokine A24, MPIF2, SCYA24) (PE)

Eotaxin 2 is an eosinophil-specific chemokine which is expressed principally by the jejunum and spleen. Expression is induced by allergen challenge. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount...