BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (PE)

BCL2/adenovirus E1B 19kD protein-interacting protein 3 (BNIP3) is a member of the NIP3 family of proteins. As a homodimer, BNIP3 can overcome BCL2 suppression and induce apoptosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF Storage and Stability: Store product at 4°C in the dark....