GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to...
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
Store the GDF9 antibody at 2-8°C (with azide) or aliquot and store at -20°C or colder (without azide).
Safety Statement
This GDF9 antibody is available for research use only.
Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.
STORAGE BUFFER
1 mg/ml in 1X PBS; BSA free, sodium azide free
APPLICATION DETAILS
ELISA: order Ab without BSA for coating,Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml for 30 minutes at RT
APPLICATION NOTES
Optimal dilution of the GDF9 antibody should be determined by the researcher.
LOCALIZATION
Cytoplasmic (secreted)
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
Store the GDF9 antibody at 2-8°C (with azide) or aliquot and store at -20°C or colder (without azide).
Safety Statement
This GDF9 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.