Matrix metallopeptidase 9, or 92 kDa type IV collagenase, is part of a family of proteins involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP9 degrades type IV and V collagens.
Matrix metallopeptidase 9, or 92 kDa type IV collagenase, is part of a family of proteins involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP9 degrades type IV and V collagens.
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the MMP9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This MMP9 antibody is available for research use only.
Amino acids KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF of mouse MMP9 were used as the immunogen for the MMP9 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,ELISA: 0.1-0.5ug/ml
APPLICATION NOTES
Optimal dilution of the MMP9 antibody should be determined by the researcher.
LOCALIZATION
Nuclear, cytoplasmic
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the MMP9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This MMP9 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.