Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.
Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Mmp-12 antibody is available for research use only.
Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml
APPLICATION NOTES
Optimal dilution of the Mmp-12 antibody should be determined by the researcher.
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Mmp-12 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.