Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different...
Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the KPNA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This KPNA2 antibody is available for research use only.
This KPNA2 antibody is available for research use only.
FORMAT
Antigen affinity purified
APPLICATION.1
WB
HOST SPECIES
Rabbit
ISOTYPE
Rabbit IgG
REACTIVITY SPECIES
Human
CLONALITY
Polyclonal (rabbit origin)
PURIFICATION
Antigen affinity
IMMUNOGEN
Amino acids 2-46 (STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ) were used as the immunogen for the KPNA2 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western Blot: 0.5-1ug/ml
APPLICATION NOTES
Optimal dilution of the KPNA2 antibody should be determined by the researcher.
BUFFER
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the KPNA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This KPNA2 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.