Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as...
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Srb1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Srb1 antibody is available for research use only.
Amino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western blot: 0.1-0.5ug/ml,Flow cytometry: 1-3ug/million cells
APPLICATION NOTES
Optimal dilution of the Srb1 antibody should be determined by the researcher.
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the Srb1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This Srb1 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.