Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified...
Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified...
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the RPA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This RPA1 antibody is available for research use only.
Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody.
STORAGE BUFFER
0.5mg/ml if reconstituted with 0.2ml sterile DI water
APPLICATION DETAILS
Western blot: 0.5-1ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
APPLICATION NOTES
Optimal dilution of the RPA1 antibody should be determined by the researcher.
Questions & Answers (0)
Citations (0)
Shipping & Handling
Shipped In
Cold Packs
Safety & Storage
Storage Temperature
After reconstitution, the RPA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Safety Statement
This RPA1 antibody is available for research use only.
Regulatory & Compliance
We’re currently in BETA - Interested in joining? Let us know and we’ll get you set up with early access.