PIGP (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit P, Down Syndrome Critical Region Protein 5, Down Syndrome Critical Region Protein C, Phosphatidylinositol-glycan Biosynthesis Class P Protein, PIG-P, DCRC, DSCR5, DSCRC, NPD010) (Biotin)

Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C...