UBE2H (Ubiquitin-conjugating Enzyme E2 H, UbcH2, Ubiquitin Carrier Protein H, UBCH, Ubiquitin-conjugating Enzyme E2-20K, Ubiquitin-protein Ligase H) (AP)

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL Storage and Stability: Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For...